Description

  • Product name

    Recombinant Human C5ORF4 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ RFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLV VDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFL YPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHR
    • Amino acids

      1 to 191
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Chromosome 5 open reading frame 4
    • FLJ13758
    • Hypothetical protein LOC10826
  • Relevance

    C5ORF4 belongs to the Sterol Desaturase family. It's function remains unknown. The Sterol Desaturase family includes C-5 sterol desaturase and C-4 sterol methyl oxidase. Members of this family are involved in cholesterol biosynthesis and biosynthesis of a plant cuticular wax. These enzymes contain many conserved histidine residues. Members of this family are integral membrane proteins. C5ORF4 has been identified as a putative tumour suppressor.
  • Cellular localization

    Cell Membrane (Potential).

Images

  • ab161171 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161171.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up