Overview

  • Product name

    Recombinant Human C6orf134/TAT protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGA VLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGD HVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLK SSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSWLTW PFCFLTI TLREEGVCHLESVDLQQQIMTIIDELGKASAKAQNLSAPITSASRMQSNR HV VYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLCIL DFYIHESVQRHGHG RELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKH YNLETTVPQVNNFVIFEGFFAHQH RPPAPSLRATRHSRAAAVDPTPAA PARKLPPKRAEGDIKPYS
    • Molecular weight

      52 kDa including tags
    • Amino acids

      2 to 224

Associated products

Specifications

Our Abpromise guarantee covers the use of ab135006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as C6orf134

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.5% Glutathione, 0.017% Potassium chloride, 0.05% DTT, 0.64% Tris HCl, 20% Glycerol, 0.65% Sodium chloride

General Info

  • Alternative names

    • Acetyltransferase mec 17 homolog
    • Acetyltransferase mec-17 homolog
    • Alpha TAT
    • Alpha tubulin acetyltransferase 1
    • Alpha tubulin N acetyltransferase
    • Alpha-TAT
    • Alpha-tubulin N-acetyltransferase
    • ATAT_HUMAN
    • ATAT1
    • Chromosome 6 open reading frame 134
    • Hypothetical protein LOC79969
    • MEC17
    • Nbla00487
    • TAT
    see all
  • Function

    Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. May affect microtubule stability and regulate microtubule dynamics. May be involved in neuron development.
  • Sequence similarities

    Belongs to the acetyltransferase ATAT1 family.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab135006 at 3.2 µg stained with Coomassie.

References

ab135006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up