Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEE ALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVT N
    • Amino acids
      321 to 421
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • adenylate kinase domain containing 1
    • adenylate kinase domain containing 2
    • Adenylate kinase domain-containing protein 1
    • Adenylate kinase domain-containing protein 2
    • AKD1
    • AKD1_HUMAN
    • AKD2
    • C6orf224
    • chromosome 6 open reading frame 199
    • chromosome 6 open reading frame 224
    • dJ70A9.1
    • FLJ16163
    • FLJ25791
    • FLJ34784
    • FLJ42177
    • Gm234
    • Gm7127
    • MGC126763
    • MGC138153
    • MGC177059
    • MGC180194
    • MGC184281
    • MGC26954
    • OTTHUMP00000040459
    • OTTHUMP00000040461
    • RP1-70A9
    see all
  • Sequence similarities
    Belongs to the adenylate kinase family.
  • Post-translational
    modifications
    Isoform 1 is phosphorylated on Ser-724.
  • Information by UniProt

Images

  • ab165965 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up