Recombinant Human C9orf115 protein (ab165419)

Overview

  • Product name
    Recombinant Human C9orf115 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGM AVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGR SVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISC LNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLIL DHIRERSQGPSLGP
    • Amino acids
      1 to 214
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC51999
    • Peptidyl tRNA hydrolase 1 homolog
    • Peptidyl tRNA hydrolase 1 homolog (S. cerevisiae)
    • Probable peptidyl tRNA hydrolase
    • PTH
    • PTH1
    • PTRH1 peptidyl tRNA hydrolase 1 homolog (S. cerevisiae)
    see all
  • Relevance
    C9orf115 belongs to the Peptidyl-tRNA hydrolase (PTH) family. Peptidyl-tRNA hydrolase (PTH) is a monomeric protein that cleaves the ester bond linking the nascent peptide and tRNA when peptidyl-tRNA is released prematurely from the ribosome. This ensures the recycling of peptidyl-tRNAs into tRNAs produced through abortion of translation and is essential for cell viability.

Images

  • ab165419 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up