Description

  • Product name

    Recombinant Human C9orf156 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGLEEPGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQP SICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAK VQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHG TPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQ RQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREI AVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQG SRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLG QLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFT VDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS
    • Amino acids

      1 to 441
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Chromosome 9 open reading frame 156
    • HSPC219
    • NAP1
    • Nef (lentivirus myristoylated factor) associated protein 1
    • Nef associated protein 1
    • RP11 23B15.3
    • Thioesterase NAP1
    • vNAP1
    see all
  • Relevance

    C9orf156 hydrolyzes acyl-CoA thioesters (in vitro). It has a preference for substrates with medium chain length (C10-C14) and is inactive towards substrates with C18 or C20 aliphatic chains. Its physiological function is not known. C9orf156 interacts with Nef from human immunodeficiency virus (HIV-1).

Images

  • ab162586 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up