Overview

  • Product name
    Recombinant Human C9orf3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDIQLDPARDDLPLMANTSHILVKHYVLDLDVDFESQVIEGTIVLFLEDG NRFKKQNSSIEEACQSESNKACKFGMPEPCHIPVTNARTFSSEMEYNDFA ICSKGEKDTSDKDGNHDNQEHASGISSSKYCCDTGNHGSEDFLLVLDCCD LSVLKVEEVDVAAVPGLEKFTRSPELTVVSEEFRNQIVRELVTLPANRWR EQLDYYARCSQAPGCGELLFDTDTWSLQIRKTGAQTATDFPHAIRIWYKT KPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRA AASFVVLMSGENSAKPTQLWEECSSWYYYVTMPMPASTFTIAVGCWTEMK METWSSNDLATERPFSPSEANFRHVGVCSHMEYPCRFQNASATTQEIIPH RVFAPVCLTGACQETLLRLIPPCLSAAHSVLGAHPFSRLDVLIVPANFPS LGMARPSKDKTGHTSDSGASVIKHGLNPEKIFMQVHYLKGYFLLRFLAKR LGDETYFSFLRKFVHTFHGQLILSQDFLQMLLENIPEEKRLELSVENIYQ DWLESSGIPKPLQRERRAGAECGLARQVRAEVTKWIGVNRRPRKRKRREK EEVFEKLLPDQLVLLLEHLLEQKTLSPRTLQSLQRTYHLQDQDAEVRHRW CELIVKHKFTKAYKSVERFLQEDQAMGVYLYGELMVSEDARQQQLARRCF ERTKEQMDRSSAQVVAEMLF
    • Amino acids
      1 to 720
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aminopeptidase O
    • AP O
    • APO
    • Chromosome 9 open reading frame 3
  • Relevance
    C9orf3 is an aminopeptidase and belongs to the M1 family of metallopeptidases or gluzincins. Aminopeptidases catalyze the hydrolysis of amino acid residues from the N-terminus of peptide or protein substrates. C9orf3 is able to cleave angiotensin III to generate angiotensin IV, a bioactive peptide of the renin-angiotensin pathway but not able to cleave angiotensin I and angiotensin II. It may play a role in the proteolytic processing of bioactive peptides in tissues where it is expressed. C9orf3 is predominantly expressed in pancreas, placenta, liver, testis and heart and at lower level in brain, lung and kidney. There are four named isoforms.
  • Cellular localization
    Cytoplasm

Images

  • ab164687 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up