Description

  • Product name

    Recombinant Human C9orf80 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPS LNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPR LDPE
    • Amino acids

      1 to 104
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Chromosome 9 open reading frame 80
    • hSSBIP1
    • MISE
    • RP11-276E15.2
    • Sensor of single-strand DNA complex subunit C
    • Sensor of ssDNA subunit C
    • Single-stranded DNA-binding protein-interacting protein 1
    • SOSS C
    • SOSS complex subunit C
    • SOSS-C
    • SOSSC
    • SOSSC_HUMAN
    • SSB-interacting protein 1
    • Ssbip1
    see all
  • Function

    Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.
  • Sequence similarities

    Belongs to the SOSS-C family.
  • Cellular localization

    Nucleus. Localizes to nuclear foci following DNA damage.
  • Information by UniProt

Images

  • ab163681 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up