Description

  • Product name

    Recombinant Human C9orf86 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDI VKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGV VMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRD FIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQL ETNQLDMDATLEELSVQQETEDQNYGIFLEMMEARSRGHASPLAANGQSP SPGSQSPVVPAGAVSTGSSSPGTPQPAPQLPLNAAPPSSVPPVPPSEALP PPACPSAPAPRRSIISRPPPWGWRLRGALGRRGQWPPWGGGRACHCLGRH LPLYHRLCRCPVAAVCASELEEAGHWWSPGWALQVLGLQAQCEPALQEGR GQLASARLGGHPGPLGAEPPVFLRDVTEAQEGPVRVCLQRLGRGRLAVGC ALPRHLLALRAHLGPQHAYGSASGREP
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      44 to 520

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA216L13.9
    • Chromosome 9 open reading frame 86
    • FLJ10101
    • FLJ13045
    • GTP-binding protein Parf
    • Hypothetical protein LOC55684
    • KIAA1984
    • OTTHUMP00000022608
    • OTTHUMP00000022610
    • OTTHUMP00000022612
    • OTTHUMP00000022613
    • OTTHUMP00000022614
    • OTTHUMP00000022615
    • PARF
    • Partner of ARF
    • pp8875
    • Putative GTP binding protein Parf
    • Rab like GTP binding protein 1
    • Rab like GTP binding protein 1C
    • Rab like protein 1
    • Rab-like protein 1
    • RBEL1
    • RBEL1_HUMAN
    • RP11-216L13.9
    see all
  • Function

    May enhance cellular proliferation. May reduce growth inhibitory activity of CDKN2A.
  • Post-translational
    modifications

    Isoform RBEL1A is O-glycosylated, while other isoforms are not.
  • Cellular localization

    Nucleus. Predominantly nuclear and Cytoplasm. Predominantly cytoplasmic.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132636 stained with Coomassie Blue.

References

ab132636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up