Overview

  • Product name

    Recombinant Human CAB3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ QLERAKHKPVAFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYS NDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQKARRSGNPSSLSDIGNR RSPPPSLAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKAL FDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSIAEV QSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLA EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSL MPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSA NGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY
    • Molecular weight

      81 kDa including tags
    • Amino acids

      1 to 484

Specifications

Our Abpromise guarantee covers the use of ab132175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

    Protein previously labeled as CACNB3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAB3
    • CACB3_HUMAN
    • Cacnb3
    • CACNLB3
    • Calcium channel voltage dependent beta 3 subunit
    • Calcium channel voltage-dependent subunit beta 3
    • FLJ58949
    • Voltage-dependent L-type calcium channel subunit beta-3
    see all
  • Function

    The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
  • Tissue specificity

    Expressed mostly in brain, smooth muscle and ovary.
  • Sequence similarities

    Belongs to the calcium channel beta subunit family.
    Contains 1 SH3 domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132175 stained with Coomassie Blue.

References

ab132175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up