Description

  • Product name

    Recombinant Human CAB39/MO25 protein
    See all CAB39/MO25 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab98230 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPFPFGKSHKSPADIVKNLKESMAVLEKQD ISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLL STLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFML LKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSL KLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQI RDLKRPAQQEA
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1 to 341
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as CAB39. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Cab39
    • CAB39_HUMAN
    • Calcium binding protein 39
    • Calcium-binding protein 39
    • CGI 66
    • CGI-66
    • CGI66
    • MO25
    • MO25 alpha
    • Mouse protein 25 alpha
    • Protein Mo25
    see all
  • Function

    Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, forms a regulatory complex capable of stimulating the activity of STK11.
  • Sequence similarities

    Belongs to the Mo25 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98230

References

ab98230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up