Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MCQCVRVCVCVCACATQRASHSALPGTTISVKDWRLCLLDQFDACARSGL SEPRSLTLRVPSCGKPLPGPGARLGREVTPCLSFAFAWCWLKMCQEEQTS YMVVQTSEEGLAADAELPGPLLMLAQNCAVMHNLLGPACIFLRKGFAENR QPDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMEL IELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDT NGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVR MMSR
    • Molecular weight

      59 kDa including tags
    • Amino acids

      1 to 304

Specifications

Our Abpromise guarantee covers the use of ab131886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CABP 1
    • CaBP1
    • CABP1_HUMAN
    • Calbrain
    • Calcium binding protein 1
    • Calcium binding protein 5
    • Calcium-binding protein 1
    • Caldendrin
    • HCALB BR
    • HCALB_BR
    see all
  • Function

    Modulates calcium-dependent activity of inositol 1,4,5-triphosphate receptors (ITPRs). Inhibits agonist-induced intracellular calcium signaling. Enhances inactivation and does not support calcium-dependent facilitation of voltage-dependent P/Q-type calcium channels. Causes calcium-dependent facilitation and inhibits inactivation of L-type calcium channels by binding to the same sites as calmodulin in the C-terminal domain of CACNA1C, but resulting in an opposit effects on channel function. Suppresses the calcium-dependent inactivation of CACNA1D (By similarity). Inhibits TRPC5 channels. Prevents NMDA receptor-induced cellular degeneration.
  • Tissue specificity

    Retina and brain. Somatodendritic compartment of neurons. Calbrain was found exclusively in brain where it is abundant in the hippocampus, habenular area in the epithalamus and in the cerebellum.
  • Sequence similarities

    Contains 4 EF-hand domains.
  • Domain

    EF-1 binds magnesium constitutively under physiological conditions, EF-3 and EF-4 bind calcium cooperatively and EF-2 binds neither calcium nor magnesium.
  • Post-translational
    modifications

    Phosphorylated. The phosphorylation regulates the activity.
  • Cellular localization

    Cytoplasm > cell cortex. Cell membrane. S-CaBP1 is localized at or near the plasma membrane; Cytoplasm > cytoskeleton. Cytoplasm > perinuclear region. Cell membrane. Golgi apparatus. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. L-CaBP1 is associated most likely with the cytoskeletal structures, whereas S-CaBP1 is localized at or near the plasma membrane and Cytoplasm > cytoskeleton. L-CaBP1 is associated most likely with the cytoskeletal structures.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131886 at approximately 59.18 kDa.

References

ab131886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up