Description

  • Product name

    Recombinant Human CABP4 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTEPWLALGTSWTLPLQDRELGPEELDELQAAFEEFDTDRDGYISHRELG DCMRTLGYMPTEMELLEVSQHIKMRMGGRVDFEEFVELIGPKLREETAHM LGVRELRIAFREFDRDRDGRITVAELREAVPALLGEPLAGPELDEMLREV DLNGDGTVDFDEFVMMLSRH
    • Amino acids

      1 to 170
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CABP 4
    • CaBP4
    • CABP4_HUMAN
    • Calcium binding protein 4
    • Calcium-binding protein 4
    • CSNB 2B
    • CSNB2B
    see all
  • Function

    Involved in normal synaptic function through regulation of Ca(2+) influx and neurotransmitter release in photoreceptor synaptic terminals and in auditory transmission. Modulator of CACNA1D and CACNA1F, suppressing the calcium-dependent inactivation and shifting the activation range to more hyperpolarized voltages.
  • Tissue specificity

    Expressed in retina and in the inner hair cells (IHC) of the cochlea.
  • Involvement in disease

    Defects in CABP4 are the cause of congenital stationary night blindness type 2B (CSNB2B) [MIM:610427]. Congenital stationary night blindness is a non-progressive retinal disorder characterized by impaired night vision.
  • Sequence similarities

    Contains 4 EF-hand domains.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation levels change with the light conditions and regulate the activity.
  • Cellular localization

    Cytoplasm. Found in rod spherules and cone pedicles of the presynapses from both types of photoreceptors.
  • Information by UniProt

Images

  • ab163462 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up