Description

  • Product name

    Recombinant Human CACNA2D2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQK LVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY
    • Amino acids

      65 to 162
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha 2 delta calcium channel subunit
    • CA2D2_HUMAN
    • CACNA2D
    • Cacna2d2
    • Calcium channel, voltage-dependent, alpha 2/delta subunit 2
    • Calcium channel, voltage-dependent, alpha 2/delta subunit 2 gene 26
    • Calcium voltage gated channel auxiliary subunit alpha2delta 2
    • Gene 26
    • KIAA0558
    • LUAC11.1
    • Voltage-dependent calcium channel subunit alpha-2/delta-2
    • Voltage-dependent calcium channel subunit delta-2
    • Voltage-gated calcium channel subunit alpha-2/delta-2
    see all
  • Function

    The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) and possibly T-type (CACNA1G). Overexpression induces apoptosis.
  • Tissue specificity

    Predominantly present in cerebellar cortex. Present in various lung tumor cell lines, while it is absent in normal lung (at protein level). Highly expressed in heart, lung, testis, pancreas and skeletal muscle. Also expressed in kidney, liver, placenta and brain.
  • Sequence similarities

    Belongs to the calcium channel subunit alpha-2/delta family.
    Contains 1 cache domain.
    Contains 1 VWFA domain.
  • Domain

    The MIDAS-like motif in the VWFA domain binds divalent metal cations and is required to promote trafficking of the alpha-1 (CACNA1) subunit to the plasma membrane by an integrin-like switch.
  • Post-translational
    modifications

    May be proteolytically processed into subunits alpha-2-2 and delta-2 that are disulfide-linked. It is however unclear whether such cleavage really takes place in vivo and has a functional role.
  • Cellular localization

    Membrane. Colocalizes with CACNA1A in lipid raft fractions.
  • Information by UniProt

Images

  • ab152967 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up