Overview

  • Product name

    Recombinant Human CACNB1/CAB1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTT SNSFVRQGSAESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKP VAFAVRTNVGYNPSPGDEVPVQGVAITFEPKDFLHIKEKYNNDWWIGRLV KEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLGDVVTG TRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQK ALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPK VLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEH LAEYLEAYWKATHPPSSTPPNPLLNRTMATAALAASPAPVSNLQGPYLAS GDQPLERATGEHASMHEYPGELGQPPGLYPSSHPPGRAGTLRALSRQDTF DADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWED EEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
    • Molecular weight

      92 kDa including tags
    • Amino acids

      1 to 598

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as CACNB1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAB1
    • CACB1_HUMAN
    • CACNB1
    • CACNLB1
    • Calcium channel L type beta 1 polypeptide
    • Calcium channel voltage dependent beta 1 subunit
    • Calcium channel voltage-dependent subunit beta 1
    • CCHLB1
    • Dihydropyridine sensitive L type calcium channel beta 1 subunit
    • MGC41896
    • Voltage dependent L type calcium channel beta 1 subunit
    • Voltage-dependent L-type calcium channel subunit beta-1
    see all
  • Function

    The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
  • Tissue specificity

    Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle.
  • Sequence similarities

    Belongs to the calcium channel beta subunit family.
    Contains 1 SH3 domain.
  • Cellular localization

    Cell membrane > sarcolemma.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132364 stained with Coomassie Blue.

References

ab132364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up