Overview

  • Product name
    Recombinant Human CACNG3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLS PISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK
    • Amino acids
      199 to 297
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CACNG 3
    • Cacng2
    • CACNG3
    • Calcium channel voltage dependent gamma subunit 3
    • CCG3_HUMAN
    • Neuronal voltage gated calcium channel gamma 3 subunit
    • Neuronal voltage-gated calcium channel gamma-3 subunit
    • TARP gamma-3
    • Transmembrane AMPAR regulatory protein gamma-3
    • Voltage dependent calcium channel gamma 3 subunit
    • Voltage gated calcium channel gamma subunit
    • Voltage-dependent calcium channel gamma-3 subunit
    see all
  • Function
    Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
  • Sequence similarities
    Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160965 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up