Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ILLQEKPNSYLSSKKIVGLTKDDGKMLRRTKRGWMWNQFFLLEEYTGTDT QYVGKLHTDQDKGDGNLKYILTGDGAGSLFVIDENTGDIHAAKKLDREEK SLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEM SGVGTSVIQVTATDADDANYGNSAKVVYSILQGQPYFSVDPESGIIKTAL PDMSRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNNNPPRFPQS TYQFNSPESVPLGTHLGRIKANDPDVGENAEMEYSIAEGDGADMFDVITD KDTQEGIITVKQNLDFENQMLYTLRVDASNTHPDPRFLHLGPFKDTAVVK ISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYSV DRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSH IPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGH KFFFEPVPEFTLNPNFTIVDNKDNTAGIMTRKDGYSRNKMSTYLLPILIF DNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGAVDHHHH HH
    • Molecular weight

      67 kDa including tags
    • Amino acids

      22 to 615
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab152073 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from an 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • CADH9_HUMAN
    • Cadherin 9 type 2
    • Cadherin-9
    • Cadherin9
    • CDH 9
    • CDH9
    • T1 cadherin
    see all
  • Function

    Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Domain

    Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab152073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up