Description

  • Product name

    Recombinant Human Calcineurin A protein
    See all Calcineurin A proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab101870 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHTGSMSEPKAIDPKLSTTDRVVKAVPFPPSH RLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKN LLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSI ECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDA CMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPM CDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSI LRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENN VMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDEL GSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLT PTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRR DAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      1 to 511
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.077% DTT, 0.316% Tris HCl, 0.0292% EDTA, 20% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • Alpha isoform formerly PPP2B
    • Calcineurin A alpha
    • Calcineurin A1
    • CalcineurinA
    • Calmodulin dependent calcineurin A subunit alpha isoform
    • Calmodulin-dependent calcineurin A subunit alpha isoform
    • CALN
    • CALNA
    • CALNA 1
    • CALNA1
    • CAM PRP catalytic subunit
    • CAM-PRP catalytic subunit
    • CCN 1
    • CCN1
    • CNA
    • CNA 1
    • CNA alpha
    • CNA1
    • PP2BA_HUMAN
    • PPP2B
    • Ppp3ca
    • Protein phosphatase 2B catalytic subunit
    • Protein phosphatase 3 (formerly 2B) catalytic subunit alpha isoform
    • Protein phosphatase 3 catalytic subunit alpha isoform PPP3CA
    • Protein phosphatase 3 catalytic subunit alpha isozyme
    • Serine/threonine protein phosphatase 2B catalytic subunit alpha isoform
    • Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
    see all
  • Function

    Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. Dephosphorylates DNM1L, HSPB1 and SSH1.
  • Sequence similarities

    Belongs to the PPP phosphatase family. PP-2B subfamily.
  • Cellular localization

    Nucleus. Colocalizes with ACTN1 and MYOZ2 at the Z line in heart and skeletal muscle.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of 3µg ab101870.
  • Anti-Calcineurin A antibody (ab3673) at 1/1000 dilution + Recombinant Human Calcineurin A protein (ab101870) at 0.1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Exposure time: 10 seconds

References

ab101870 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up