Description

  • Product name

    Recombinant Human Calcineurin B/CNB protein
  • Purity

    > 90 % SDS-PAGE.
    ab103786 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKL DLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVS QFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 170
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Calcineurin B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.58% Sodium chloride, 10% Glycerol, 0.316% Tris HCl, 0.0308% DTT

General Info

  • Alternative names

    • alpha isoform (calcineurin B, type I)
    • calcineurin B, type I (19kDa)
    • Calcineurin subunit B type 1
    • CALNB1
    • CANB1_HUMAN
    • Cna2
    • CNB
    • CNB1
    • OTTHUMP00000201960
    • OTTHUMP00000201961
    • Ppp3r1
    • PPP3R1 protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform
    • protein phosphatase3 (formerly2B), regulatory subunit B, alpha isoform
    • Protein phosphatase 2B regulatory subunit 1
    • Protein phosphatase 2B regulatory subunit B alpha
    • protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I)
    • Protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I)
    • Protein phosphatase 3 regulatory subunit B alpha
    • Protein phosphatase 3 regulatory subunit B alpha isoform 1
    see all
  • Function

    Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
  • Sequence similarities

    Belongs to the calcineurin regulatory subunit family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103786.

References

ab103786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up