Overview

  • Product name

    Recombinant Human Calcitonin protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      APFRSALESSPADPATLSEDEARLLLAALVQNYVQMKASELEQEQEREGS SLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSD LERDHRPHVSMPQNANHHHHHH
    • Molecular weight

      13 kDa
    • Amino acids

      26 to 141
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • Alpha CGRP
    • alpha type CGRP
    • CALC 1
    • CALC A
    • CALC1
    • calcitonin 1
    • calcitonin gene related peptide 1
    • calcitonin gene related peptide I
    • calcitonin related polypeptide alpha
    • CGRP
    • CGRP 1
    • CGRP I
    • CGRP1
    • CT
    • katacalcin
    • KC
    see all
  • Relevance

    Calcitonin is a 32 amino acid peptide hormone synthesized by the parafollicular cells of the thyroid. It causes a rapid, but short lived, reduction in serum calcium and phosphate by promoting the incorporation of those ions in the bones. This effect is opposite to that of parathyroid hormone. Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.
  • Cellular localization

    Cytoplasmic and Secreted

References

ab153793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up