Description

  • Product name

    Recombinant Human Calcium binding protein P22
  • Purity

    > 95 % SDS-PAGE.
    ab99141 was purified by using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMMGSRASTLLRDEELEEIKKETGFSHSQIT RLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVN FRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEK ISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKV LEKVDVEQKMSIRFLH
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 195
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Calcineurin B homolog
    • Calcineurin B homologous protein
    • Calcineurin homologous protein
    • Calcineurin like EF hand protein 1
    • Calcium binding protein CHP
    • Calcium binding protein p22
    • Calcium-binding protein CHP
    • Calcium-binding protein p22
    • chp
    • CHP1_HUMAN
    • Sid 470
    • Sid470
    • SLC9A1 binding protein
    • SLC9A1BP
    • Wrch2
    see all
  • Function

    Required for constitutive membrane traffic. Inhibits GTPase-stimulated Na(+)/H(+) exchange. Also inhibits calcineurin phosphatase activity. Required for activity of SLC9A1/NHE1.
  • Tissue specificity

    Ubiquitously expressed. Has been found in fetal eye, lung, liver, muscle, heart, kidney, thymus and spleen.
  • Sequence similarities

    Contains 4 EF-hand domains.
  • Post-translational
    modifications

    Both N-myristoylation and calcium-mediated conformational changes are essential for its function in exocytic traffic.
    Phosphorylated; decreased phosphorylation is associated with an increase in exchange activity. The phosphorylation state may regulate the binding to NHE1.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99141.

References

ab99141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up