Recombinant Human Calcium channel L type DHPR alpha 2 subunit/CACNA2D1 protein (Tagged) (ab235738)

Overview

  • Product name

    Recombinant Human Calcium channel L type DHPR alpha 2 subunit/CACNA2D1 protein (Tagged)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNK MIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYS FYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN
    • Molecular weight

      32 kDa including tags
    • Amino acids

      528 to 668
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab235738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Calcium channel L type DHPR alpha 2 subunit

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CA2D1_HUMAN
    • CACN A2
    • CACNA2
    • Cacna2d1
    • CACNL2A
    • Calcium channel L type alpha 2 polypeptide
    • Calcium channel voltage dependent alpha 2/delta subunit 1
    • CCHL2A
    • Dihydropyridine receptor alpha 2 subunit
    • Dihydropyridine sensitive L type calcium channel alpha 2/delta subunit
    • Dihydropyridine sensitive L type calcium channel subunits alpha 2/delta
    • L type calcium channel subunit alpha 2
    • MHS 3
    • MHS3
    • Voltage dependent calcium channel subunit alpha 2/delta 1
    • Voltage gated calcium channel subunit alpha 2/delta 1
    • Voltage-dependent calcium channel subunit delta-1
    • Voltage-gated calcium channel subunit alpha-2/delta-1
    see all
  • Function

    The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling.
  • Tissue specificity

    Isoform 1 is expressed in skeletal muscle. Isoform 2 is expressed in the central nervous system. Isoform 2, isoform 4 and isoform 5 are expressed in neuroblastoma cells. Isoform 3, isoform 4 and isoform 5 are expressed in the aorta.
  • Sequence similarities

    Belongs to the calcium channel subunit alpha-2/delta family.
    Contains 1 cache domain.
    Contains 1 VWFA domain.
  • Domain

    The MIDAS-like motif in the VWFA domain binds divalent metal cations and is required to promote trafficking of the alpha-1 (CACNA1) subunit to the plasma membrane by an integrin-like switch.
  • Post-translational
    modifications

    Proteolytically processed into subunits alpha-2-1 and delta-1 that are disulfide-linked.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab235738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up