Overview

  • Product name

    Recombinant Human CALML3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMADQLTEEQVTEFKEAFSLFDKDGDG CITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARK MKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMI RAADTDGDGQVNYEEFVRVLVSK
    • Molecular weight

      19 kDa including tags
    • Amino acids

      1 to 149
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab139257 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • CALL3_HUMAN
    • CALML3
    • Calmodulin like 3
    • Calmodulin related protein NB 1
    • Calmodulin-like protein 3
    • Calmodulin-related protein NB-1
    • CaM like protein
    • CaM-like protein
    • CLP
    • OTTHUMP00000019004
    see all
  • Function

    May be similar to that of authentic calmodulin and may actually compete with calmodulin by binding, with different affinities, to cellular substrates.
  • Tissue specificity

    Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
  • Sequence similarities

    Belongs to the calmodulin family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139257.

References

ab139257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up