Overview

  • Product name

    Recombinant Human Calpain 11 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVAHINNSRLKAKGVGQHDNAQNFGNQSFEELRAACLRKGELFEDPLFPA EPSSLGFKDLGPNSKNVQNISWQRPKDIINNPLFIMDGISPTDICQGILG DCWLLAAIGSLTTCPKLLYRVVPRGQSFKKNYAGIFHFQIWQFGQWVNVV VDDRLPTKNDKLVFVHSTERSEFWSALLEKAYAKLSGSYEALSGGSTMEG LEDFTGGVAQSFQLQRPPQNLLRLLRKAVERSSLMGCSIEVTSDSELESM TDKMLVRGHAYSVTGLQDVHYRGKMETLIRVRNPWGRIEWNGAWSDSARE WEEVASDIQMQLLHKTEDGEFWMSYQDFLNNFTLLEICNLTPDTLSGDYK SYWHTTFYEGSWRRGSSAGGCRNHPGTFWTNPQFKISLPEGDDPEDDAEG NVVACTCLVALMQKNWRHARQQGAQLQTIGFVLYAVPKEFQNIQDVHLKK EFFTKYQDHGFSEIFTNSREVSSQLRLPPGEYIIIPSTFEPHRDADFLLR VFTEKHSESWELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIG VYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKI LWKKLKKWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVAR YADDDLIIDFDSFISCFLRLKTMFTFFLTMDPKNTGHICLSLEQWLQMTM WG
    • Molecular weight

      107 kDa including tags
    • Amino acids

      38 to 739

Specifications

Our Abpromise guarantee covers the use of ab132354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Calcium activated neutral proteinase 11
    • Calpain11
    • CAPN 11
    • CAPN11
  • Relevance

    Calpain 11 is an intracellular, calcium-dependent cysteine protease. Calpain 11 was first described in the testis, and more weakly in mammary gland and thymus, and maps to chromosome 6. Domains in the large subunit include the amino terminal domain-I, the proteinase domain-II, domain-III, and the EF-hand domain-IV, making calpain 11 most similar to the "classical" calpains 1 & 2. Sequence alignments place calpain 11 closest to chicken calpain u/m, and it may be that calpain 11 is the human orthologue of this protein.
  • Cellular localization

    Cytoplasmic vesicle; secretory vesicle; acrosome

Images

  • 12.5% SDS-PAGE analysis of ab132354 stained with Coomassie Blue.

References

ab132354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up