For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-calpain-2-protein-ab114344.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Signaling Pathway Calcium Signaling Calpain
Share by email

Recombinant Human Calpain 2 protein (ab114344)

  • Datasheet
Reviews (2)Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Calpain 2 protein (ab114344)

    Key features and details

    • Expression system: Wheat germ
    • Suitable for: ELISA, WB, SDS-PAGE

    Description

    • Product name

      Recombinant Human Calpain 2 protein
      See all Calpain 2 proteins and peptides
    • Expression system

      Wheat germ
    • Accession

      P17655
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPS FPAIPSALGFKELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQG ALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFHFQFWQYGEWV EVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGAT TEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADS EAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTS DTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEED GESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSK NFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIR VFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISA FELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARF ADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
      • Predicted molecular weight

        103 kDa including tags
      • Amino acids

        1 to 700

    Associated products

    • Related Products

      • Anti-Calpain 2 antibody [EPR2562Y] (ab75994)

    Specifications

    Our Abpromise guarantee covers the use of ab114344 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      ELISA

      Western blot

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.3% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • Calcium activated neutral proteinase
      • Calcium activated neutral proteinase 2
      • Calcium-activated neutral protease 2, catalytic subunit
      • Calcium-activated neutral proteinase 2
      • CALP80
      • Calpain 2 (m/II) large subunit
      • Calpain 2 catalytic subunit
      • Calpain 2 large catalytic subunit
      • Calpain 2 large subunit
      • Calpain 2, large [catalytic] subunit
      • Calpain large polypeptide L2
      • Calpain M type
      • Calpain M-type
      • Calpain-2 catalytic subunit
      • Calpain-2 large subunit
      • Calpain2
      • CAN2_HUMAN
      • CANP 2
      • CANP L2
      • CANP2
      • CANPL 2
      • CANPL2
      • CANPml
      • Capa2
      • CAPN 2
      • CAPN2
      • FLJ39928
      • M calpain
      • M calpin
      • M type
      • M-calpain
      • mCANP
      • Millimolar calpain
      • Millimolar-calpain
      see all
    • Function

      Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
    • Tissue specificity

      Ubiquitous.
    • Sequence similarities

      Belongs to the peptidase C2 family.
      Contains 1 calpain catalytic domain.
      Contains 3 EF-hand domains.
    • Cellular localization

      Cytoplasm. Cell membrane. Translocates to the plasma membrane upon Ca(2+) binding.
    • Target information above from: UniProt accession P17655 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Calpain 2 protein (ab114344)
      SDS-PAGE - Recombinant Human Calpain 2 protein (ab114344)
      ab114344 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab114344? Please let us know so that we can cite the reference in this datasheet.

    ab114344 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-3 of 3 Abreviews or Q&A

    Functional assay on the calpain2 activity

    Poor
    Abreviews
    Abreviews
    Application
    Functional Studies
    We ordered and tried the Recombinant Human Calpain 2 protein (ab114344) for the functional assay on its activity using calpain activity kit (ab65308, Abcam, our order number for this kit #3561741), and use the calpain1 in the kit (ab65308) as positive control. There was a very good result for the calpain1 positive control as described in the manual. However, there was the similar RFU value of calpain2 product (ab114344) with the negative control, which means the calpain2 protein product (ab114344) is not functional and is not suitable for the calpain2 functional study.

    Xuefei Tian

    Verified customer

    Submitted Dec 24 2019

    Functional study testing on the calpain2 protein product

    Poor
    Abreviews
    Abreviews
    abreview image
    Application
    Other - Do not use
    We tried the Recombinant Human Calpain2 protein (ab114344) for the functional studies on its activity using calpain activity kit (ab65308, Abcam), along with the calpain1 in the kit as positive control and without calpain as the negative control. There was a very good result for the calpain1 positive control as described in the manual. However, there was no bioactivity of the calpain 2 protein product detected. It suggests that the calpain2 protein product (ab114344) is not suitable for the functional study purpose.

    Abcam user community

    Verified customer

    Submitted Nov 22 2019

    Question

    Dear technical team,

    Our customer is looking for Calpain 2 protein with active form.

    https://www.abcam.com/Calpain-2-protein-ab114344.html

    If it is not an active form, she needs to treat calcium to make this proteinactive form but,

    calcium binding site is N-terminal and she isworried about itsN-terminal had tagged.

    Let me know if ab114344 is active form or not and tagging has possibility to inhibit calcium binding.

    Bset regards,

    Read More

    Abcam community

    Verified customer

    Asked on Mar 21 2012

    Answer

    Thank you for contacting us.

    Unfortunately we have not tested Calpain 2 protein (ab114344) for its activity, and we have had no reports of other customers doing so either. I can therefore not guarantee that the protein will retain activity in biological systems.

    As your customer has noticed, the protein is N-terminally fused with a purification tag. This could potentially affect the activity of the protein. If your customer would like to try this protein for its activity they would be eligible for a testing discount. More information on this scheme can be found from the following link:

    https://www.abcam.com/collaboratordiscount

    I hope this information has been of help. If you require any further information please do not hesitate to contact us again.

    Read More

    Abcam Scientific Support

    Answered on Mar 21 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.