Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPS FPAIPSALGFKELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQG ALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFHFQFWQYGEWV EVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGAT TEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADS EAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTS DTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEED GESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSK NFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIR VFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISA FELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARF ADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL VEHHHHHH
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 700
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 50% Glycerol, 0.03% DTT, 49% PBS

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Calcium activated neutral proteinase
    • Calcium activated neutral proteinase 2
    • Calcium-activated neutral protease 2, catalytic subunit
    • Calcium-activated neutral proteinase 2
    • CALP80
    • Calpain 2 (m/II) large subunit
    • Calpain 2 catalytic subunit
    • Calpain 2 large catalytic subunit
    • Calpain 2 large subunit
    • Calpain 2, large [catalytic] subunit
    • Calpain large polypeptide L2
    • Calpain M type
    • Calpain M-type
    • Calpain-2 catalytic subunit
    • Calpain-2 large subunit
    • Calpain2
    • CAN2_HUMAN
    • CANP 2
    • CANP L2
    • CANP2
    • CANPL 2
    • CANPL2
    • CANPml
    • Capa2
    • CAPN 2
    • CAPN2
    • FLJ39928
    • M calpain
    • M calpin
    • M type
    • M-calpain
    • mCANP
    • Millimolar calpain
    • Millimolar-calpain
    see all
  • Function
    Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 3 EF-hand domains.
  • Cellular localization
    Cytoplasm. Cell membrane. Translocates to the plasma membrane upon Ca(2+) binding.
  • Information by UniProt

References

ab172812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up