Description

  • Product name

    Recombinant Human Calpain 2 protein (His tag)
    See all Calpain 2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSK TRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEE ILARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVH SAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKK PPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGA EEVESNGSLQKLIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRH EDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTKMDGNWRRGS TAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQ RKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLR EVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEAN LEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKS DGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRS GTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRL ETLFKIFKQLDPENTGTIELDLISWLCFSVL
    • Predicted molecular weight

      82 kDa including tags
    • Amino acids

      20 to 700
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab231157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Calcium activated neutral proteinase
    • Calcium activated neutral proteinase 2
    • Calcium-activated neutral protease 2, catalytic subunit
    • Calcium-activated neutral proteinase 2
    • CALP80
    • Calpain 2 (m/II) large subunit
    • Calpain 2 catalytic subunit
    • Calpain 2 large catalytic subunit
    • Calpain 2 large subunit
    • Calpain 2, large [catalytic] subunit
    • Calpain large polypeptide L2
    • Calpain M type
    • Calpain M-type
    • Calpain-2 catalytic subunit
    • Calpain-2 large subunit
    • Calpain2
    • CAN2_HUMAN
    • CANP 2
    • CANP L2
    • CANP2
    • CANPL 2
    • CANPL2
    • CANPml
    • Capa2
    • CAPN 2
    • CAPN2
    • FLJ39928
    • M calpain
    • M calpin
    • M type
    • M-calpain
    • mCANP
    • Millimolar calpain
    • Millimolar-calpain
    see all
  • Function

    Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 3 EF-hand domains.
  • Cellular localization

    Cytoplasm. Cell membrane. Translocates to the plasma membrane upon Ca(2+) binding.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Human Calpain 2 protein (His tag) (ab231157).

    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab231157 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Functional Studies
Unfortunately, the Calpain 2 recombinant protein did not cleave our protein of interest (reported several time in the litterature to be cleaved by Calpain 2).
We have tested several concentration of the Calpain 2 as different concentration of CaCl2 in our buffer.
If an alternative product is available from your website, we will be pleased to buy it.

Ms. Anne-Laure Mahul

Verified customer

Submitted Apr 11 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up