Overview

  • Product name

    Recombinant Human Calpain 3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYE PHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSN KELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIA GDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKL NLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQL YDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVL EWLQLTMYA
    • Molecular weight

      60 kDa including tags
    • Amino acids

      1 to 309

Specifications

Our Abpromise guarantee covers the use of ab114576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Calcium-activated neutral proteinase 3
    • calpain 3, (p94)
    • Calpain L3
    • Calpain large polypeptide L3
    • Calpain p94
    • calpain p94, large [catalytic] subunit
    • calpain, large polypeptide L3
    • Calpain-3
    • CAN3_HUMAN
    • CANP 3
    • CANP3
    • CANPL3
    • CAPN3
    • LGMD 2A
    • LGMD2
    • LGMD2A
    • Lp82
    • Lp85
    • MGC10767
    • MGC11121
    • MGC14344
    • MGC4403
    • Muscle-specific calcium-activated neutral protease 3
    • muscle-specific calcium-activated neutral protease 3 large subunit
    • nCL-1
    • New calpain 1
    • p94
    see all
  • Function

    Calcium-regulated non-lysosomal thiol-protease.
  • Tissue specificity

    Isoform I is skeletal muscle specific.
  • Involvement in disease

    Defects in CAPN3 are the cause of limb-girdle muscular dystrophy type 2A (LGMD2A) [MIM:253600]. LGMD2A is an autosomal recessive degenerative myopathy characterized by progressive symmetrical atrophy and weakness of the proximal limb muscles and elevated serum creatine kinase. The symptoms usually begin during the first two decades of life, and the disease gradually worsens, often resulting in loss of walking ability 10 or 20 years after onset.
  • Sequence similarities

    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 4 EF-hand domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab114576 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up