Recombinant Human Calpain small subunit 1 protein (ab158025)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGG GGGGGGTAMRILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQ FRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAV MDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEA AGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDG TGQIQVNIQEWLQLTMFS
    • Amino acids
      1 to 268
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 30K
    • Calcium activated neutral proteinase
    • Calcium activated neutral proteinase small subunit
    • Calcium dependent protease small subunit
    • Calcium dependent protease small subunit 1
    • Calcium-activated neutral proteinase small subunit
    • Calcium-dependent protease small subunit
    • Calcium-dependent protease small subunit 1
    • Calpain 4
    • Calpain 4 small subunit
    • Calpain 4 small subunit (30K)
    • Calpain regulatory subunit
    • Calpain small polypeptide
    • Calpain small subunit 1
    • Calpain4
    • CalpainS1
    • CANP
    • CANP small subunit
    • CANPS
    • CAPN 4
    • CAPN S1
    • CAPN4
    • CAPNS
    • CAPNS 1
    • Capns1
    • CDPS
    • CPNS1_HUMAN
    • CSS 1
    • CSS1
    see all
  • Function
    Regulatory subunit of the calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
  • Sequence similarities
    Contains 5 EF-hand domains.
  • Domain
    The contact of the 5th EF-hand domain from each monomer allows the formation of the homodimer and also appears to mediate the contact between the large catalytic subunit and small regulatory subunit for the formation of the heterodimer.
    EF-hand domains are paired. EF-hand 1 is paired with EF-hand 2 and EF-hand 3 is paired with EF-hand 4. The fifth EF-hand domain, left unpaired, does not bind the calcium but is responsible of the dimerization by EF-embrace. The first four EF-hand domains bind calcium, however it is not sure if the binding of EF-hand 4 to calcium is physiologically relevant.
  • Cellular localization
    Cytoplasm. Cell membrane. Translocates to the plasma membrane upon calcium binding.
  • Information by UniProt

Images

  • ab158025 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up