Recombinant Human CAMK1D protein (ab163488)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFA VKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQL VSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENL LYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSK AVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISD SAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAP STLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK
    • Amino acids
      1 to 385
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A630059D12Rik
    • Calcium/calmodulin dependent protein kinase ID
    • Calcium/calmodulin dependent protein kinase type 1D
    • Calcium/calmodulin-dependent protein kinase I-delta
    • Calcium/calmodulin-dependent protein kinase type 1D
    • CaM K1
    • CaM KI delta
    • CaM kinase I delta
    • CaM kinase ID
    • CaM-KI delta
    • CAMK 1D
    • CAMK1D
    • CaMKI delta
    • CamKI like protein kinase
    • CamKI-like protein kinase
    • CaMKID
    • CKLiK
    • E030025C11Rik
    • KCC1D_HUMAN
    • OTTHUMP00000019119
    • OTTHUMP00000019120
    • OTTHUMP00000045030
    • RP11 462F15.1
    see all
  • Function
    Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. May regulate calcium-mediated granulocyte function. May play a role in apoptosis of erythroleukemia cells. Activates MAP kinase MAPK3 (By similarity). In vitro, phosphorylates transcription factor CREM isoform Beta and probably CREB1.
  • Tissue specificity
    Broadly expressed. Highly and mostly expressed in polymorphonuclear leukocytes (neutrophilic and eosinophilic granulocytes) while little or no expression is observed in monocytes and lymphocytes.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
  • Cellular localization
    Cytoplasm. Nucleus. Predominantly cytoplasmic (Probable). Also nuclear upon activation.
  • Information by UniProt

Images

  • ab163488 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up