Recombinant Human CAMK1D protein (BSA and azide free) (ab185386)

Description

  • Product name

    Recombinant Human CAMK1D protein (BSA and azide free)
  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSMARENGESSSSWKKQAEDIKKIFE FKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLR KIKHENIVALEDIYESPNHLYLVMQ LVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPEN LLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYS KAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDIS DSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRK NFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLA PSTLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK
    • Predicted molecular weight

      69 kDa including tags
    • Amino acids

      1 to 385
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab185386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

General Info

  • Alternative names

    • A630059D12Rik
    • Calcium/calmodulin dependent protein kinase ID
    • Calcium/calmodulin dependent protein kinase type 1D
    • Calcium/calmodulin-dependent protein kinase I-delta
    • Calcium/calmodulin-dependent protein kinase type 1D
    • CaM K1
    • CaM KI delta
    • CaM kinase I delta
    • CaM kinase ID
    • CaM-KI delta
    • CAMK 1D
    • CAMK1D
    • CaMKI delta
    • CamKI like protein kinase
    • CamKI-like protein kinase
    • CaMKID
    • CKLiK
    • E030025C11Rik
    • KCC1D_HUMAN
    • OTTHUMP00000019119
    • OTTHUMP00000019120
    • OTTHUMP00000045030
    • RP11 462F15.1
    see all
  • Function

    Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. May regulate calcium-mediated granulocyte function. May play a role in apoptosis of erythroleukemia cells. Activates MAP kinase MAPK3 (By similarity). In vitro, phosphorylates transcription factor CREM isoform Beta and probably CREB1.
  • Tissue specificity

    Broadly expressed. Highly and mostly expressed in polymorphonuclear leukocytes (neutrophilic and eosinophilic granulocytes) while little or no expression is observed in monocytes and lymphocytes.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
  • Cellular localization

    Cytoplasm. Nucleus. Predominantly cytoplasmic (Probable). Also nuclear upon activation.
  • Information by UniProt

References

ab185386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up