Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVT EQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWS RNSKPV
    • Amino acids
      305 to 410
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha CaMKII
    • Calcium calmodulin dependent protein kinase II
    • Calcium/calmodulin dependent protein kinase II alpha B subunit
    • Calcium/calmodulin dependent protein kinase type II alpha chain
    • Calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha
    • Calcium/calmodulin-dependent protein kinase II alpha
    • Calcium/calmodulin-dependent protein kinase II-alpha
    • Calcium/calmodulin-dependent protein kinase type II subunit alpha
    • Calcium/calmodulin-dependent protein kinase type IIA
    • CaM kinase II alpha chain
    • CaM kinase II alpha subunit
    • CaM kinase II subunit alpha
    • CaMK II alpha subunit
    • CaMK-II subunit alpha
    • Camk2a
    • CAMKA
    • CaMKII
    • CaMKIINalpha
    • EC 2.7.11.17
    • KCC2A_HUMAN
    • KIAA0968
    • MGC123320
    • MGC139375
    • MGC155201
    • mKIAA0968
    • PK2CDD
    • PKCCD
    • R74975
    • zgc:112538
    • zgc:123320
    see all
  • Function
    CaM-kinase II (CAMK2) is a prominent kinase in the central nervous system that may function in long-term potentiation and neurotransmitter release. Member of the NMDAR signaling complex in excitatory synapses it may regulate NMDAR-dependent potentiation of the AMPAR and synaptic plasticity.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cell junction > synapse > presynaptic cell membrane. Cell junction > synapse. Postsynaptic lipid rafts.
  • Information by UniProt

Images

  • ab158019 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up