Description

  • Product name

    Recombinant human CaMKII beta protein
    See all CaMKII beta proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKL SARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFE DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG AAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWAC GVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLIN QMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL KGAILTTMLATRNFSAAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPP AALESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDP GLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGED AACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVA PLQ
    • Predicted molecular weight

      81 kDa including tags
    • Amino acids

      1 to 503
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Calcium/calmodulin dependent protein kinase (CaM kinase) II beta
    • Calcium/calmodulin dependent protein kinase II beta
    • Calcium/calmodulin dependent protein kinase IIB
    • Calcium/calmodulin dependent protein kinase type II beta chain
    • calcium/calmodulin-dependent protein kinase II beta
    • Calcium/calmodulin-dependent protein kinase type II subunit beta
    • CAM 2
    • CaM kinase II beta chain
    • CaM kinase II beta subunit
    • CaM kinase II subunit beta
    • CaM-kinase II beta chain
    • CAM2
    • CAMK 2
    • CAMK 2B
    • CaMK II beta subunit
    • CaMK II subunit beta
    • CaMK-II subunit beta
    • CAMK2
    • CaMK2 beta
    • Camk2b
    • CAMKB
    • CaMKII beta subunit
    • CaMKIIB
    • KCC2B_HUMAN
    • MGC29528
    • Proline rich calmodulin dependent protein kinase
    • proline rich calmodulin-dependent protein kinase
    see all
  • Function

    CaM-kinase II (CAMK2) is a prominent kinase in the central nervous system that may function in long-term potentiation and neurotransmitter release. Member of the NMDAR signaling complex in excitatory synapses, it may regulate NMDAR-dependent potentiation of the AMPAR and synaptic plasticity.
  • Tissue specificity

    Widely expressed. Expressed in adult and fetal brain. Expression is slightly lower in fetal brain.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132961 stained with Coomassie Blue.
  • Kinase Assay using ab132961.
    Fig.1: SDS-PAGE gel
    Fig.2: Autoradiography of SDS-PAGE gel.

    Kinase substrates:
    H3 histone, family 3A - calf thymus - Molecular weight: approx. 16.5-17 kDa on SDS-PAGE
    Myelin basic protein - bovine brain - Molecular weight: approx. 21-22 kDa on SDS-PAGE
    Histone H1.0 - calf thymus - Molecular weight: approx. 32-33 kDa on SDS-PAGE
    Beta-casein protein- bovine milk - Molecular weight: approx. 33-34 kDa on SDS-PAGE

References

ab132961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up