Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATTATCTRFTDDYQLFEELGKGAFSGVRRCVKKTPTQEYAAKIINTKKL SARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFE DIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKG AAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWAC GVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLIN QMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGV KKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEII KITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFEN LLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEE TRVWHRRDGKWLNVHYHCSGAPAAPLQ
    • Molecular weight

      84 kDa including tags
    • Amino acids

      1 to 527

Specifications

Our Abpromise guarantee covers the use of ab132986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CaM kinase II
    • CaM kinase II gamma chain
    • CaM kinase II subunit gamma
    • CAMK
    • CAMK II
    • CaMK II subunit gamma
    • CAMK2G
    • CAMKG
    • CAMKII
    see all
  • Cellular localization

    Cell Membrane

Images

  • 12.5% SDS-PAGE analysis of ab132986 stained with Coomassie Blue.
  • Kinase Assay using ab132986.
    Fig.1: SDS-PAGE gel
    Fig.2: Autoradiography of SDS-PAGE gel.

    Kinase substrates:
    H3 histone, family 3A - calf thymus - Molecular weight: approx. 16.5-17 kDa on SDS-PAGE
    Myelin basic protein - bovine brain - Molecular weight: approx. 21-22 kDa on SDS-PAGE
    Histone H1.0 - calf thymus - Molecular weight: approx. 32-33 kDa on SDS-PAGE
    Beta-casein protein- bovine milk - Molecular weight: approx. 33-34 kDa on SDS-PAGE

References

ab132986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up