Description

  • Product name

    Recombinant Human CAMLG/CAML protein
  • Purity

    > 85 % SDS-PAGE.
    ab167835 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMESMAVATDGGERPGVPAGSGLSASQR RAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLS VPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDV NLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQE DGNTTEEFDSFR
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 189
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as CAMLG

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • calcium modulating cyclophilin ligand
    • calcium modulating ligand
    • Calcium signal modulating cyclophilin ligand
    • CAML
    • cyclophilin B binding protein
    • MGC163197
    see all
  • Relevance

    The immunosuppressant drug cyclosporin A blocks a calcium dependent signal from the T cell receptor (TCR) that normally leads to T cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [Entrez Gene]
  • Cellular localization

    Membrane; Multi pass membrane protein.

Images

  • 15% SDS-PAGE analysis of ab167835 (3 µg).

References

ab167835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up