Overview

  • Product name
    Recombinant Human CAND1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVV KMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAND 1
    • Cand1
    • CAND1_HUMAN
    • Cullin associated and neddylation dissociated 1
    • Cullin associated and neddylation dissociated protein 1
    • Cullin associated NEDD8 dissociated protein 1
    • Cullin-associated and neddylation-dissociated protein 1
    • Cullin-associated NEDD8-dissociated protein 1
    • DKFZP434M1414
    • FLJ10114
    • FLJ10929
    • FLJ38691
    • FLJ90441
    • KIAA0829
    • p120 CAND1
    • TATA binding protein interacting protein 120A
    • TBP interacting protein
    • TBP interacting protein of 120 kDa A
    • TBP Interacting Protein TIP120A
    • TBP-interacting protein 120A
    • TBP-interacting protein of 120 kDa A
    • TIP120
    • TIP120 protein
    • TIP120A
    see all
  • Function
    Enhances transcription from various types of promoters (By similarity). Regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. Prevents neddylation of CUL1 by physically blocking access to the neddylation site. Disrupts interactions between CUL1 and SKP1 and between CUL1 and F-box proteins.
  • Sequence similarities
    Belongs to the CAND family.
    Contains 27 HEAT repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163246 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up