Overview

  • Product name
    Recombinant Human CAPNS2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISE AAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDL MNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNN IKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANE DGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS
    • Amino acids
      1 to 248
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Calpain S2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium dependent protease small subunit 2
    • Calpain S2
    • Calpain Short Chain 2
    • Calpain Small 2
    • Calpain Small Subunit 2
    • CAPNS2
    • CSS2
    see all
  • Relevance
    Both M-calpain and m-calpain are ubiquitously expressed in mammalian cells, and are countered by the endogenous calpain inhibitor, calpastatin. Other calpain family members (calpain-3, calpain-5, calpain-9, etc) have more limited tissue distribution, and perhaps different functions. The calpain family members consist of a common small subunit (Calpain-S1), and a large variable subunit. It is not clear that all calpains form heterodimers with a small subunit, but calpain-S1 is known to form a heterodimer with calpain-1 and also with calpain-2. CAPNS2 was recently discovered, and initial studies indicate that both small subunits may act as chaperonins to help with folding, or accessory proteins to help localize the calpains. Domains in the small subunit include the amino terminal domain-V (a glycine-rich sequence that is removed on activation of calpain, shorter in calpain-S2 than in calpain S1) and domain-VI, the calcium binding, EF hand domain.
  • Cellular localization
    Cytoplasmic; Translocates to the plasma membrane upon calcium binding

Images

  • ab164557 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up