Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVE IVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWT WDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKK KSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGR QLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGKEGGSH TGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLL QQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHIS LLVKQVQELELKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLH SPPLGAGLADFAHPAGSPLGRRDCLVKLECFRFLPPEDTPPPAQGEALLG GLELIKFRESGIASEYESNTDESEERDSWSQEELPRLLNVLQRQELGDGL DDEIAV
    • Molecular weight
      83 kDa including tags
    • Amino acids
      1 to 506

Specifications

Our Abpromise guarantee covers the use of ab131928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as CAPON

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6330408P19Rik
    • C terminal PDZ domain ligand of neuronal nitric oxide synthase
    • C terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON)
    • C terminal PDZ ligand of neuronal nitric oxide synthase protein
    • C-terminal PDZ ligand of neuronal nitric oxide synthase protein
    • CAPON
    • CAPON_HUMAN
    • Carboxyl terminal PDZ ligand of neuronal nitric oxide synthase protein
    • Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
    • Ligand of neuronal nitric oxide synthase with carboxyl terminal PDZ domain
    • MGC138500
    • Nitric oxide synthase 1 (neuronal) adaptor protein
    • Nitric oxide synthase 1 adaptor protein
    • Nos1ap
    see all
  • Function
    Adapter protein involved in neuronal nitric-oxide (NO) synthesis regulation via its association with nNOS/NOS1. The complex formed with NOS1 and synapsins is necessary for specific NO and synapsin functions at a presynaptic level. Mediates an indirect interaction between NOS1 and RASD1 leading to enhance the ability of NOS1 to activate RASD1. Competes with DLG4 for interaction with NOS1, possibly affecting NOS1 activity by regulating the interaction between NOS1 and DLG4.
  • Sequence similarities
    Contains 1 PID domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131928 stained with Coomassie Blue.

References

ab131928 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up