Overview

  • Product name

    Recombinant Human CAPS1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFNVMVDAKAQSTKLCSMEMGQEFAKMWHQYHSKIDELIEETVKEMITLL VAKFVTILEGVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVAD AYVTFVRHSQDVLRDKVNEEMYIERLFDQWYNSSMNVICTWLTDRMDLQL HIYQLKTLIRMVKKTYRDFRLQGVLDSTLNSKTYETIRNRLTVEEATASV SEGGGLQGISMKDSDEEDEEDD
    • Molecular weight

      52 kDa including tags
    • Amino acids

      1137 to 1358

Specifications

Our Abpromise guarantee covers the use of ab132386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CADPS
    • CADPS1
    • Calcium dependent secretion activator 1
    • Calcium-dependent activator protein for secretion 1
    • CAPS
    • KIAA1121
    • rCAPS
    see all
  • Relevance

    CAPS1 (Ca2+-dependent activator protein for secretion) belongs to the CAPS/Cadps family which consists of two members, CAPS1 and CAPS2. The CAPS family proteins are involved in the secretion of different secretory substances in developing and postnatal brains. In addition CAPS1 regulates catecholamine release from neuroendocrine cells and is expressed predominantly in the brain.
  • Cellular localization

    Cytoplasmic

Images

  • 12.5% SDS-PAGE analysis of ab132386 stained with Coomassie Blue.

References

ab132386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up