Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGA AHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDH LRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDG QQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYE DGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTM SDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 286

Specifications

Our Abpromise guarantee covers the use of ab132127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cap Z
    • Cappa 1
    • Cappa1
    • Capping protein (actin filament) muscle Z line alpha 1
    • Capping protein alpha 1
    • Capping protein muscle Z line alpha 1
    • CAPZ
    • CapZ alpha 1
    • CapZ alpha-1
    • CAPZA 1
    • Capza1
    • CAZ 1
    • CAZ1
    • CAZA1_HUMAN
    • F actin capping protein alpha 1 subunit
    • F-actin-capping protein subunit alpha-1
    see all
  • Function

    F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.
  • Sequence similarities

    Belongs to the F-actin-capping protein alpha subunit family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132127 stained with Coomassie Blue.

References

ab132127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up