Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDV RLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSR FLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHY SNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTA QVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAE NEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
    • Molecular weight

      34 kDa including tags
    • Amino acids

      1 to 286
    • Tags

      T7 tag N-Terminus
    • Additional sequence information

      15 aa (T7) tag. NP_006126.

Specifications

Our Abpromise guarantee covers the use of ab211946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    This protein was expressed in E. coli as inclusion bodies, refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • Cap Z
    • Cappa 1
    • Cappa1
    • Capping protein (actin filament) muscle Z line alpha 1
    • Capping protein alpha 1
    • Capping protein muscle Z line alpha 1
    • CAPZ
    • CapZ alpha 1
    • CapZ alpha-1
    • CAPZA 1
    • Capza1
    • CAZ 1
    • CAZ1
    • CAZA1_HUMAN
    • F actin capping protein alpha 1 subunit
    • F-actin-capping protein subunit alpha-1
    see all
  • Function

    F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.
  • Sequence similarities

    Belongs to the F-actin-capping protein alpha subunit family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

References

ab211946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up