Description

  • Product name

    Recombinant Human Carbonic Anhydrase 13/CA13 protein
    See all Carbonic Anhydrase 13/CA13 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab202181 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSPMGSMSRLSWGYREHNGPIHWKEFFPIADGD QQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENK SVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSD KYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRF TNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKF RSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      1 to 262
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_940986.

Specifications

Our Abpromise guarantee covers the use of ab202181 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as CA13

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • CA 13
    • CA XIII
    • CA-XIII
    • CA13
    • CA13 carbonic anhydrase XIII
    • CAH13_HUMAN
    • Carbonate dehydratase XIII
    • Carbonic anhydrase 13
    • Carbonic anhydrase XIII
    • CAXIII
    • EC=4.2.1.1
    see all
  • Function

    Reversible hydration of carbon dioxide.
  • Tissue specificity

    Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
    Contains 1 alpha-carbonic anhydrase domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202181 (3 µg).

References

ab202181 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202181.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up