Description

  • Product name

    Recombinant Human Carbonic Anhydrase 14/CA14 protein
    See all Carbonic Anhydrase 14/CA14 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab174400 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSADGGQHWTYEGPHGQDHWPASYPECGN NAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPS TLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSD SYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTS VPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLE KLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      16 to 290
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain. NCBI Accession No. NP_036245.

Specifications

Our Abpromise guarantee covers the use of ab174400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • CA 14
    • CA XIV
    • CA-XIV
    • CA14
    • CAH14_HUMAN
    • Carbonate dehydratase XIV
    • Carbonic anhydrase 14
    • Carbonic anhydrase XIV
    • Carbonic dehydratase
    • CAXIV
    • UNQ690/PRO1335
    see all
  • Function

    Reversible hydration of carbon dioxide.
  • Tissue specificity

    High expression in all parts of the central nervous system and lower expression in adult liver, heart, small intestine, colon, kidney, urinary bladder and skeletal muscle.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174400 (3μg).

References

ab174400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up