Recombinant Human Carbonic Anhydrase 14/CA14 protein (His tag) (ab217818)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQ PHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQK GSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIE VGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGS LTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRA LQPLNQRMVFASFIQAGSSYTTGEM
    • Molecular weight

      32 kDa including tags
    • Amino acids

      16 to 290
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (AAH34412).

Specifications

Our Abpromise guarantee covers the use of ab217818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    Reconstitute the lyophilized product sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CA 14
    • CA XIV
    • CA-XIV
    • CA14
    • CAH14_HUMAN
    • Carbonate dehydratase XIV
    • Carbonic anhydrase 14
    • Carbonic anhydrase XIV
    • Carbonic dehydratase
    • CAXIV
    • UNQ690/PRO1335
    see all
  • Function

    Reversible hydration of carbon dioxide.
  • Tissue specificity

    High expression in all parts of the central nervous system and lower expression in adult liver, heart, small intestine, colon, kidney, urinary bladder and skeletal muscle.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT reduced ab217818 followed by staining overnight with Coomassie Blue.

    DTT-reduced protein migrates as 45-50 kDa in SDS-PAGE due to glycosylation.

References

ab217818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up