Overview

  • Product name

    Recombinant Human Carbonic Anhydrase 4/CA4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLG RFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHW SDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAF LVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYF RYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYY DKEQTVSMKDNVRPLQQLGQRTVIK
    • Molecular weight

      30 kDa
    • Amino acids

      19 to 283

Specifications

Our Abpromise guarantee covers the use of ab151908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Carbonic Anhydrase IV

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.50
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride

General Info

  • Alternative names

    • CA IV
    • CA4
    • CAH4_HUMAN
    • CAIV
    • Car4
    • Carbonate dehydratase IV
    • Carbonic anhydrase 4
    • Carbonic dehydratase
    • Carbonic dehydratase IV
    • EC 4.2.1.1
    • Retinitis pigmentosa 17 (autosomal dominant)
    • RP17
    see all
  • Information by UniProt

References

ab151908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up