Recombinant human Carbonic Anhydrase 9/CA9 protein (Active) (ab198056)

Description

  • Product name

    Recombinant human Carbonic Anhydrase 9/CA9 protein (Active)
    See all Carbonic Anhydrase 9/CA9 proteins and peptides
  • Biological activity

    Specific Activity: ≥ 30,000 pmol/min/µg

    Assay conditions: 15 mM Tris-HCl, pH7.4, 100mM NaCl, and 3mM p-Nitrophenyl acetate (PNPA). Incubate for 30 minutes at room temperature. Absorbance is measured at 405nM.

  • Purity

    >= 65 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGS LKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACA GRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLP PGLEMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLST AFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQ VPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLH TLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLN SCLAAGDHHHHHH
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      59 to 414
    • Tags

      His tag C-Terminus
    • Additional sequence information

      GenBank Accession No. NM_001216

Specifications

Our Abpromise guarantee covers the use of ab198056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab198056 is resistant to acetazolamide.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.81% Imidazole
    Constituents: 0.63% Tris HCl, 0.04% Tween, 20% Glycerol, 0.64% Sodium chloride, 0.02% Potassium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CA-IX
    • CA9
    • CAH9_HUMAN
    • CAIX
    • Carbonate dehydratase IX
    • Carbonic anhydrase 9
    • Carbonic anhydrase IX
    • Carbonic dehydratase
    • G250
    • Membrane antigen MN
    • MN
    • P54/58N
    • pMW1
    • RCC associated protein G250
    • RCC-associated antigen G250
    • Renal cell carcinoma-associated antigen G250
    see all
  • Function

    Reversible hydration of carbon dioxide. Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia.
  • Tissue specificity

    Expressed primarily in carcinoma cells lines. Expression is restricted to very few normal tissues and the most abundant expression is found in the epithelial cells of gastric mucosa.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
    Contains 1 alpha-carbonic anhydrase domain.
  • Post-translational
    modifications

    Asn-346 bears high-mannose type glycan structures.
  • Cellular localization

    Nucleus. Nucleus, nucleolus. Cell membrane. Cell projection, microvillus membrane. Found on the surface microvilli and in the nucleus, particularly in nucleolus.
  • Information by UniProt

Images

  • Specific activity of ab198056 was determined to be 30,000 pmol/min/μg

  • 4-20% SDS-PAGE analysis of 3.8 µg ab198056 with Coomassie staining.

References

ab198056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up