Recombinant Human Carbonic Anhydrase III protein (BSA and azide free) (ab173078)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVS YDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSS DDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIG HENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTP PCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPI NNRVVRASFKLEHHHHHH
    • Molecular weight
      36 kDa including tags
    • Amino acids
      2 to 260
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.24% Tris, 0.88% Sodium chloride

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names
    • CA III
    • CA-III
    • Ca3
    • CAH3_HUMAN
    • CAIII
    • Car3
    • Carbonate dehydratase III
    • Carbonic anhydrase 3
    • Carbonic anhydrase III
    • Carbonic anhydrase III muscle specific
    • EC 4.2.1.1
    • Epididymis secretory sperm binding protein Li 167mP
    • HEL S 167mP
    see all
  • Function
    Reversible hydration of carbon dioxide.
  • Tissue specificity
    Muscle specific.
  • Sequence similarities
    Belongs to the alpha-carbonic anhydrase family.
  • Developmental stage
    At 6 weeks gestation, transcripts accumulate at low levels in the somites and at high levels throughout the notochord. As gestation continues, CA3 becomes abundant in all developing muscle masses and continues at high to moderate levels in the notochord.
  • Post-translational
    modifications
    S-glutathionylated in hepatocytes under oxidative stress.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab173078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up