Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHS TVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHS YEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQN KPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVL PVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGASR NPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYS YAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSDDW AYDQGIRYSF TFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLYVDHHHHHH
    • Molecular weight
      47 kDa including tags
    • Amino acids
      16 to 417
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution
  • Form
    Liquid
  • Additional notes

     This product was previously labelled as Carboxypeptidase B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 5.50
    Constituents: 0.39% MES, 0.88% Sodium chloride

General Info

  • Alternative names
    • Carboxypeptidase B
    • Carboxypeptidase B1
    • Carboxypeptidase B1 (tissue)
    • CarboxypeptidaseB
    • CarboxypeptidaseB1
    • CBPB1_HUMAN
    • CP B1
    • CPB
    • CPB 1
    • CPB1
    • DKFZp779K1333
    • Pancreas specific protein
    • Pancreas-specific protein
    • Pancreatic carboxypeptidase B
    • Pancreatic carboxypeptidase B1
    • PASP
    • PCPB
    • Procarboxypeptidase B
    • Procarboxypeptidase B pancreatic
    • Protaminase
    • Tissue carboxypeptidase B
    see all
  • Tissue specificity
    Pancreas.
  • Sequence similarities
    Belongs to the peptidase M14 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up