Recombinant Human Carcino Embryonic Antigen CEA protein (His tag) (ab222987)

Description

  • Product name

    Recombinant Human Carcino Embryonic Antigen CEA protein (His tag)
    See all Carcino Embryonic Antigen CEA proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab222987 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVI GTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEA TGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQS LPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVL YGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQEL FIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNP VEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVT RNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLS LSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSAS GHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLW WVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDP VTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQ QHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLS ALEHHHHHH
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      35 to 685
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 35 to 685. The signal peptide and propeptide are not included (NP_004354).

Specifications

Our Abpromise guarantee covers the use of ab222987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Carcinoembryonic antigen
    • Carcinoembryonic antigen-related cell adhesion molecule 5
    • CD66e
    • CEA
    • Ceacam5
    • CEAM5_HUMAN
    • DKFZp781M2392
    • Meconium antigen 100
    • OTTHUMP00000199032
    • OTTHUMP00000199033
    • OTTHUMP00000199034
    see all
  • Function

    Cell surface glycoprotein that plays a role in cell adhesion and in intracellular signaling. Receptor for E.coli Dr adhesins.
  • Tissue specificity

    Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 7 Ig-like (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Complex immunoreactive glycoprotein with a MW of 180 kDa comprising 60% carbohydrate.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222987.

    MWt 70-150 kDa (SDS-PAGE under reducing conditions).

References

ab222987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up