Overview

  • Product name

    Recombinant Human CARD8 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRE LQYTKTGIFFQAEACVTNDTVYRELPCVSETLCDISHFFQEDDETEAEPL LFRAVPECQLSGGDIPSVSEEQESSEGQDSGDICSEENQIVSSYASKVCF EIEEDYKNRQFLGPEGNVDVELIDKSTNRYSVWFPTAGWYLWSATGLGFL VRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAVAEIHL PHSISLQAGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMG ILLRIASGTRLSIPITSNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDE EDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMPKWISSL
    • Molecular weight

      70 kDa including tags
    • Amino acids

      1 to 392

Specifications

Our Abpromise guarantee covers the use of ab132292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Apoptotic protein NDPP 1
    • Apoptotic protein NDPP1
    • CARD 8
    • CARD inhibitor of NF kappa B activating ligand
    • CARD inhibitor of NF kappaB activating ligand
    • CARD inhibitor of NF kappaB activating ligands
    • CARD-inhibitor of NF-kappa-B-activating ligand
    • CARD8
    • CARD8_HUMAN
    • CARDINAL
    • Caspase recruitment domain containing protein 8
    • Caspase recruitment domain family member 8
    • Caspase recruitment domain protein 8
    • Caspase recruitment domain-containing protein 8
    • DACAR
    • Dakar
    • DKFZp779L0366
    • FLJ18119
    • FLJ18121
    • KIAA0955
    • MGC57162
    • NDPP
    • NDPP 1
    • NDPP1
    • TUCAN
    • Tumor up regulated CARD containing antagonist of CASP9
    • Tumor up regulated CARD containing antagonist of caspase 9
    • Tumor up-regulated CARD-containing antagonist of CASP9
    • tumor up-regulated CARD-containing antagonist of caspase nine
    • Tumor upregulated CARD containing antagonist of CASP9
    see all
  • Function

    Inhibits NF-kappa-B activation. May participate in a regulatory mechanism that coordinates cellular responses controlled by NF-kappa-B transcription factor. May be a component of the inflammasome, a protein complex which also includes PYCARD, NALP2 and CASP1 and whose function would be the activation of proinflammatory caspases.
  • Tissue specificity

    High expression in lung, ovary, testis and placenta. Lower expression in heart, kidney and liver. Also expressed in spleen, lymph node and bone marrow.
  • Sequence similarities

    Contains 1 CARD domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132292.

References

ab132292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up