Description

  • Product name

    Recombinant Human CARD9 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DELQLQVFQCEAQLLAVEGRLRRQQLETLVLSSDLEDGSPRRSQELSLPQ DLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGPAGLPGIGAVC
    • Amino acids

      393 to 492
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CANDF2
    • CARD9
    • CARD9_HUMAN
    • Caspase recruitment domain family member 9
    • Caspase recruitment domain-containing protein 9
    • hCARD9
    see all
  • Function

    Activates NF-kappa-B via BCL10.
  • Tissue specificity

    Highly expressed in spleen. Also detected in liver, placenta, lung, peripheral blood leukocytes and in brain.
  • Involvement in disease

    Defects in CARD9 are the cause of familial candidiasis type 2 (CANDF2) [MIM:212050]. Chronic mucocutaneous candidiasis is characterized by impaired clearance of fungal infections and results in colonization and infections of the mucosa or skin, predominantly with Candida albicans. CANDF2 is an autosomal recessive chronic mucocutaneous candidiasis.
  • Sequence similarities

    Contains 1 CARD domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab163797 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up